PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01575.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 698aa    MW: 77426.4 Da    PI: 4.379
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01575.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.67.3e-51181461128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lp G+rF+Ptdeel+++yL  k++g++ ++  vi+evdi+k+ePwdLp  + v+++++ew++F++ d+ky++g+r nr+t++gyWk
  Sme2.5_01575.1_g00001.1  18 LPIGYRFRPTDEELINHYLYLKINGSDDKV-GVIREVDICKFEPWDLPdlSVVESNDNEWFYFCPIDRKYQNGQRLNRSTERGYWK 102
                              699************************999.99**************96448888999**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atg+d++v+++kg++vg+kktLv+y grap+g++t+Wv+heyr+
  Sme2.5_01575.1_g00001.1 103 ATGRDRNVVARKGAKVGMKKTLVYYIGRAPEGKRTNWVIHEYRA 146
                              ******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-5714169IPR003441NAC domain
PROSITE profilePS5100553.94918169IPR003441NAC domain
PfamPF023653.7E-2419145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MTVLPVGNQV EVPPLNTLPI GYRFRPTDEE LINHYLYLKI NGSDDKVGVI REVDICKFEP  60
WDLPDLSVVE SNDNEWFYFC PIDRKYQNGQ RLNRSTERGY WKATGRDRNV VARKGAKVGM  120
KKTLVYYIGR APEGKRTNWV IHEYRATDKS LDGSHPGQGA FVLCRLFKKN ELKEDEHVES  180
SHLDEVDLLV SSPAVRKSPT NDELLGTVTP SPVMESDGNK SNPTKTSGGK TRDTRLSIDS  240
CGNSCAAGDA EDLMLDITSV PADLELDALM GLFRDPSPEP IDWDIFYPLP SQLQVEFGSS  300
NLHAPMTNEI SCDQKDVQCQ NGINALNTSE FSNSILVSSN EISYEDSGLD LRSVQFASNS  360
INTITRAPVK DSGMCSELRS QVTHEPVKTY IFEPGFLLGN CGETAVMREI NSVATTVDEA  420
FATYNVSNDH SMGNLGFLNN GYPGEVVSSA GSGGMQVDSS LNFDESNDYS NVGTDSGFGI  480
TLRTRQMENQ PDNRQLGSGM QGTAAQRIRY QVKLQAGRVE CRMPTDSDQS GANHEGLSTV  540
SASKKSSSAA ISSDETQDTM SKEFDRDGQM AENLSGKAKG TNYFPVDEDG NVTISQPTVD  600
DDDMEEIAGV TWVEDERHMV SCDDADEYAI RVPDEEEECA LVVTQVWMEA TRRLYEQEAA  660
RIEAQRRRDE ENRHAQAEYE ERQRAALSSF SSSFYISK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-451116911168NAC domain-containing protein 19
3swm_B6e-451116911168NAC domain-containing protein 19
3swm_C6e-451116911168NAC domain-containing protein 19
3swm_D6e-451116911168NAC domain-containing protein 19
3swp_A6e-451116911168NAC domain-containing protein 19
3swp_B6e-451116911168NAC domain-containing protein 19
3swp_C6e-451116911168NAC domain-containing protein 19
3swp_D6e-451116911168NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0135210.0BT013521.1 Lycopersicon esculentum clone 132239F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006347316.10.0PREDICTED: NAC domain-containing protein 91
TrEMBLM1CKK60.0M1CKK6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000695110.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33632448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.14e-80NAC domain containing protein 62